PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA6286
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family G2-like
Protein Properties Length: 391aa    MW: 44285.6 Da    PI: 6.7659
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA6286genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.46.7e-333589155
                   G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                              kprl+Wt +LHerF+eav+qLGGs+kAtPkt+l+lm+++gLtl+h+kSHLQkYR+
  Tp57577_TGAC_v2_mRNA6286 35 KPRLKWTADLHERFIEAVNQLGGSDKATPKTVLKLMGIPGLTLYHLKSHLQKYRI 89
                              79****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.8183292IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-303390IPR009057Homeodomain-like
SuperFamilySSF466891.97E-163490IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-233590IPR006447Myb domain, plants
PfamPF002496.9E-103788IPR001005SANT/Myb domain
PfamPF143791.3E-25138184IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MYFHHQQQQA RNMHALRMHM QGSGDSGLVL STDAKPRLKW TADLHERFIE AVNQLGGSDK  60
ATPKTVLKLM GIPGLTLYHL KSHLQKYRIS KHGNGHANIS SSKIGAPTTE LVESRMSESS  120
GIHMKDLSIG LQTNKNSEIN EALNMQIEVQ RRLHEQLEVQ RHLQLRIEAQ GKYLQSVLEK  180
AKETLGSQNL GTMGLDAAKV QLSELASRVS TENLDTKFSE LKELNVLWPQ QTHEGEAIDY  240
SMSSFLTNSD DSQRDQEIHN KGMNFRPYNG TFCEEVKENT MFLSSSNDKV LDGSGEVPKQ  300
TSSLLSMNIG VHEEENFWRR NNSKEDLKGE EWKRRKSIET SGVQLKLNSD KISQDYRLAN  360
FEVKLDLNSH DDHDASQCQK FDLNGFSWNC *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1395850.0BT139585.1 Medicago truncatula clone JCVI-FLMt-20F6 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013451581.10.0myb-like transcription factor family protein
TrEMBLA0A072U7680.0A0A072U768_MEDTR; Myb-like transcription factor family protein
STRINGGLYMA02G07790.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38523163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-113G2-like family protein